| Edit |   |
| Antigenic Specificity | Cyhr1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-Cyhr1 antibody |
| Immunogen | The immunogen for anti-Cyhr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LAPGPSTHEDCLAGAWVATVIGLPLLAFDFHWVNGDRSSANLLLGGGMVL |
| Other Names | CHRP, cysteine/histidine-rich 1 |
| Gene, Accession # | Cyhr1, Accession: NM_180962 |
| Catalog # | TA329246 |
| Price | |
| Order / More Info | Cyhr1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |