| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPG20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPG20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPG20. This antibody reacts with human. The SPG20 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SPG20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQ |
|---|
| Other Names | KIAA0610SPARTIN, spastic paraplegia 20 (Troyer syndrome), Spastic paraplegia 20 protein, TAHCCP1spartin, Trans-activated by hepatitis C virus core protein 1 |
|---|
| Gene, Accession # | SPG20, Gene ID: 23111 |
|---|
| Catalog # | NBP2-54942 |
|---|
| Price | |
|---|
| Order / More Info | SPG20 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|