| Edit |   |
|---|
| Antigenic Specificity | SPG20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 50ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPG20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPG20. This antibody reacts with human. The SPG20 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SPG20(spastic paraplegia 20 (Troyer syndrome)) The peptide sequence was selected from the middle region of SPG20. Peptide sequence ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA. |
|---|
| Other Names | KIAA0610SPARTIN, spastic paraplegia 20 (Troyer syndrome), Spastic paraplegia 20 protein, TAHCCP1spartin, Trans-activated by hepatitis C virus core protein 1 |
|---|
| Gene, Accession # | SPG20, Gene ID: 23111, Accession: Q8N0X7, SwissProt: Q8N0X7 |
|---|
| Catalog # | NBP1-55345 |
|---|
| Price | |
|---|
| Order / More Info | SPG20 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|