| Edit |   |
|---|
| Antigenic Specificity | HERPUD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 50ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HERPUD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HERPUD2. This antibody reacts with human. The HERPUD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HERPUD2(HERPUD family member 2) The peptide sequence was selected from the N terminal of HERPUD2 (NP_071768). Peptide sequence MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL. |
|---|
| Other Names | endoplasmic reticulum stress-inducible, ubiquitin-likedomain member 2, FLJ22313, FLJ31032, HERPUD family member 2, homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domainmember 2 protein |
|---|
| Gene, Accession # | HERPUD2, Gene ID: 64224, Accession: Q9BSE4, SwissProt: Q9BSE4 |
|---|
| Catalog # | NBP1-59724 |
|---|
| Price | |
|---|
| Order / More Info | HERPUD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|