| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HERV |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HERV Antibody from Novus Biologicals is a rabbit polyclonal antibody to HERV. This antibody reacts with human. The HERV Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ERVWE1(endogenous retroviral family W, env(C7), member 1 (syncytin)) The peptide sequence was selected from the N terminal of ERVWE1. Peptide sequence TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR. |
|---|
| Other Names | endogenous retroviral family W, env(C7), member 1, ENV, envelope glycoprotein, Envelope polyprotein gPr73, enverin, Env-W, ENVW, HERV-7q, HERV7Q, HERV-7q Envelope protein, HERV-tryptophan envelope protein, HERV-W, HERV-W Env glycoprotein, HERV-W envelope protein, HERV-W_7q21.2 provirus ancestral Env polyprotein, HERV-W{7q21.1} provirus ancestral Env polyprotein, HERVWENV, HERV-W-ENV, HERVWenvelope protein, human endogenous retrovirus W envC7-1 envelope protein, Syncytin, syncytin A, Syncytin-1 |
|---|
| Gene, Accession # | ERVW-1, Gene ID: 30816, Accession: Q9UQF0, SwissProt: Q9UQF0 |
|---|
| Catalog # | NBP1-60024 |
|---|
| Price | |
|---|
| Order / More Info | HERV Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|