| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HES-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HES-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HES-1. This antibody reacts with human. The HES-1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG |
|---|
| Other Names | BHLHB39, bHLHb39hairy homolog (Drosophila), Class B basic helix-loop-helix protein 39, FLJ20408, Hairy and enhancer of split 1, hairy and enhancer of split 1, (Drosophila), Hairy homolog, Hairy-like protein, Hes1, HES-1, hHL, HL, HRYHHL, transcription factor HES-1 |
|---|
| Gene, Accession # | HES1, Gene ID: 3280 |
|---|
| Catalog # | NBP2-68846 |
|---|
| Price | |
|---|
| Order / More Info | HES-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|