| Edit |   |
|---|
| Antigenic Specificity | RASGRP2 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | dog, human, mouse, porcine, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-RASGRP2 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for anti-RASGRP2 antibody: synthetic peptide directed towards the N terminal of human RASGRP2. Synthetic peptide located within the following region: LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS |
|---|
| Other Names | CALDAGGEFI, CDC25L, RAS guanyl releasing protein 2 (calcium and DAG-regulated) |
|---|
| Gene, Accession # | RASGRP2, Accession: NM_153819 |
|---|
| Catalog # | TA344188 |
|---|
| Price | |
|---|
| Order / More Info | RASGRP2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|