| Edit |   |
|---|
| Antigenic Specificity | PNRC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PNRC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNRC2. This antibody reacts with human, rat. The PNRC2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of Pnrc2. Immunizing peptide sequence MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN. |
|---|
| Other Names | proline-rich nuclear receptor coactivator 2 |
|---|
| Gene, Accession # | PNRC2, Gene ID: 55629, Accession: Q66HE1 |
|---|
| Catalog # | NBP1-74252-20ul |
|---|
| Price | |
|---|
| Order / More Info | PNRC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28821679 |
|---|