| Edit |   |
| Antigenic Specificity | PNRC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PNRC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNRC2. This antibody reacts with human, rat. The PNRC2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Pnrc2. Immunizing peptide sequence MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN. |
| Other Names | proline-rich nuclear receptor coactivator 2 |
| Gene, Accession # | PNRC2, Gene ID: 55629, Accession: Q66HE1 |
| Catalog # | NBP1-74252 |
| Price | |
| Order / More Info | PNRC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28821679 |