| 产品详情 |
| Edit |   |
| Antigenic Specificity | PNUTS/PPP1R10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PNUTS/PPP1R10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNUTS/PPP1R10. This antibody reacts with human. The PNUTS/PPP1R10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PNUTS/PPP1R10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETERVNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWV |
| Other Names | CAT53, FB19PP1-binding protein of 114 kDa, MHC class I region proline-rich protein CAT53, p99, Phosphatase 1 nuclear targeting subunit, phosphatase nuclear targeting subunit, PNUTSPP1R10, Protein FB19, protein phosphatase 1 regulatory subunit 10, protein phosphatase 1, regulatory (inhibitor) subunit 10, protein phosphatase 1, regulatory subunit 10, serine/threonine-protein phosphatase 1 regulatory subunit 10 |
| Gene, Accession # | PPP1R10, Gene ID: 5514, Accession: Q96QC0, SwissProt: Q96QC0 |
| Catalog # | NBP2-38801 |
| Price | |
| Order / More Info | PNUTS/PPP1R10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|