| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PNUTS/PPP1R10 |
|---|
| Clone | 1D6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PNUTS/PPP1R10 Antibody (1D6) from Novus Biologicals is a mouse monoclonal antibody to PNUTS/PPP1R10. This antibody reacts with human. The PNUTS/PPP1R10 Antibody (1D6) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PPP1R10 (NP_002705.2, 1 a.a. - 83 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK |
|---|
| Other Names | CAT53, FB19PP1-binding protein of 114 kDa, MHC class I region proline-rich protein CAT53, p99, Phosphatase 1 nuclear targeting subunit, phosphatase nuclear targeting subunit, PNUTSPP1R10, Protein FB19, protein phosphatase 1 regulatory subunit 10, protein phosphatase 1, regulatory (inhibitor) subunit 10, protein phosphatase 1, regulatory subunit 10, serine/threonine-protein phosphatase 1 regulatory subunit 10 |
|---|
| Gene, Accession # | PPP1R10, Gene ID: 5514, Accession: NP_002705, SwissProt: NP_002705 |
|---|
| Catalog # | H00005514-M02 |
|---|
| Price | |
|---|
| Order / More Info | PNUTS/PPP1R10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|