| Edit |   |
| Antigenic Specificity | ZMYND17 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZMYND17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZMYND17. This antibody reacts with human. The ZMYND17 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human ZMYND17The immunogen for this antibody is ZMYND17. Peptide sequence SAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLMEAWLPTLLLL. |
| Other Names | FLJ39565, MYND domain containing 17, zinc finger, MYND-type containing 17 |
| Gene, Accession # | MSS51, Gene ID: 118490, Accession: NP_001019764, SwissProt: NP_001019764 |
| Catalog # | NBP1-79364-20ul |
| Price | |
| Order / More Info | ZMYND17 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |