| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZMYND19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZMYND19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZMYND19. This antibody reacts with human. The ZMYND19 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZMYND19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANG |
| Other Names | MCH-R1-interacting zinc finger protein, Melanin-concentrating hormone receptor 1-interacting zinc finger protein, MIZIPmelanin-concentrating hormone receptor 1 interacting zinc-finger protein, RP11-48C7.4, zinc finger MYND domain-containing protein 19, zinc finger, MYND domain containing 19, zinc finger, MYND-type containing 19 |
| Gene, Accession # | ZMYND19, Gene ID: 116225 |
| Catalog # | NBP2-48976 |
| Price | |
| Order / More Info | ZMYND19 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|