| Edit |   |
| Antigenic Specificity | Nmral1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-Nmral1 Antibody |
| Immunogen | The immunogen for anti-Nmral1 antibody: synthetic peptide directed towards the n terminal of mouse Nmral1. Synthetic peptide located within the following region: GATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQGAEVVRGDQD |
| Other Names | HSCARG, SDR48A1, NmrA-like family domain containing 1 |
| Gene, Accession # | Nmral1, Accession: NM_026393 |
| Catalog # | TA329936 |
| Price | |
| Order / More Info | Nmral1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |