| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IKZF5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IKZF5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IKZF5. This antibody reacts with human. The IKZF5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human IKZF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVEVSLDENSGMLVDGFERTFDGK |
|---|
| Other Names | DKFZp781B0249, FLJ22973, IKAROS family zinc finger 5 (Pegasus), Ikaros family zinc finger protein 5, PEGASUS, zinc finger protein Pegasus, zinc finger protein, subfamily 1A, 5, zinc finger protein, subfamily 1A, 5 (Pegasus), zinc finger transcription factor Pegasus, ZNFN1A5 |
|---|
| Gene, Accession # | IKZF5, Gene ID: 64376 |
|---|
| Catalog # | NBP2-58346 |
|---|
| Price | |
|---|
| Order / More Info | IKZF5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|