| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ikaros/IKZF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ikaros/IKZF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ikaros/IKZF1. This antibody reacts with human. The Ikaros/IKZF1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Ikaros/IKZF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSH |
|---|
| Other Names | DNA-binding protein Ikaros, hIk-1, IK1LyF-1, Ikaros (zinc finger protein), IKAROS family zinc finger 1 (Ikaros), Ikaros family zinc finger protein 1, IKAROSLymphoid transcription factor LyF-1, LYF1PRO0758, zinc finger protein, subfamily 1A, 1 (Ikaros), ZNFN1A1CLL-associated antigen KW-6 |
|---|
| Gene, Accession # | IKZF1, Gene ID: 10320, Accession: Q13422, SwissProt: Q13422 |
|---|
| Catalog # | NBP2-38242 |
|---|
| Price | |
|---|
| Order / More Info | Ikaros/IKZF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|