| Edit |   |
| Antigenic Specificity | ZNF475 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF475 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF475. This antibody reacts with human. The ZNF475 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZNF475 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNLVQPFICTYCDK |
| Other Names | FLJ34243, Zfp-1, zinc finger protein 1 homolog, zinc finger protein 1 homolog (mouse), Zinc finger protein 475, ZNF475zfp-1 |
| Gene, Accession # | ZFP1, Gene ID: 162239, Accession: Q6P2D0, SwissProt: Q6P2D0 |
| Catalog # | NBP2-38009 |
| Price | |
| Order / More Info | ZNF475 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |