| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF483 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF483 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF483. This antibody reacts with human. The ZNF483 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF483 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LLENLRNLEFLDFPVSKLELISQLKWVELPWLLEEVSKSSRLDESALDKIIERCLRDDDHGLMEESQQYCGSSEEDHGNQGNSKG |
|---|
| Other Names | BMZF-2zinc finger 2, bone marrow, BMZF2zinc finger protein 27 (KOX 22), Bone marrow zinc finger 2, KOX22Zinc finger protein 233, zinc finger protein 224, Zinc finger protein 255Zinc finger protein KOX22, Zinc finger protein 27, ZNF255zinc finger protein ZNF255, ZNF27ZNF233 |
|---|
| Gene, Accession # | ZNF483, Gene ID: 158399, Accession: Q8TF39, SwissProt: Q8TF39 |
|---|
| Catalog # | NBP2-31592 |
|---|
| Price | |
|---|
| Order / More Info | ZNF483 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|