| Edit |   |
|---|
| Antigenic Specificity | ZNF488 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF488 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF488. This antibody reacts with human. The ZNF488 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human ZNF488. Peptide sequence VFHMRSHHKKEHAGPDPHSQKRREEALACPVCQEHFRERHHLSRHMTSHS. |
|---|
| Other Names | FDZF2Zinc finger protein FDZF2, zinc finger protein 230 |
|---|
| Gene, Accession # | ZNF488, Gene ID: 118738, Accession: NP_694579, SwissProt: NP_694579 |
|---|
| Catalog # | NBP1-80422-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZNF488 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|