| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-17B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-17B Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-17B. This antibody reacts with human. The IL-17B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL-17B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGY |
|---|
| Other Names | Cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17Binterleukin-17 beta, IL20, IL-20interleukin-17B, interleukin 17B, interleukin 20, Interleukin-20, MGC138900, MGC138901, neuronal interleukin-17 related factor, Neuronal interleukin-17-related factor, NIRF, ZCYTO7interleukin-20 |
|---|
| Gene, Accession # | IL17B, Gene ID: 27190 |
|---|
| Catalog # | NBP1-83113 |
|---|
| Price | |
|---|
| Order / More Info | IL-17B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|