| Edit |   |
|---|
| Antigenic Specificity | OVOL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-OVOL2 Antibody |
|---|
| Immunogen | The immunogen for anti-OVOL2 antibody: synthetic peptide directed towards the middle region of human OVOL2. Synthetic peptide located within the following region: QEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK |
|---|
| Other Names | EUROIMAGE566589, ZNF339, ovo-like zinc finger 2 |
|---|
| Gene, Accession # | OVOL2, Accession: NM_021220 |
|---|
| Catalog # | TA345333 |
|---|
| Price | |
|---|
| Order / More Info | OVOL2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|