| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZFYVE26 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZFYVE26 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFYVE26. This antibody reacts with human. The ZFYVE26 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZFYVE26 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLL |
|---|
| Other Names | DKFZp686F19106, DKFZp781H1112, FYVE domain-containing centrosomal protein, FYVE-CENT, KIAA0321zinc finger FYVE domain-containing protein 26, spastic paraplegia 15 (complicated, autosomal recessive), Spastizin, SPG15, zinc finger, FYVE domain containing 26 |
|---|
| Gene, Accession # | ZFYVE26, Gene ID: 23503, Accession: Q68DK2, SwissProt: Q68DK2 |
|---|
| Catalog # | NBP2-31606 |
|---|
| Price | |
|---|
| Order / More Info | ZFYVE26 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|