| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CTDSPL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CTDSPL Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTDSPL. This antibody reacts with human. The CTDSPL Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CTDSPL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ |
|---|
| Other Names | C3orf8, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like, CTD small phosphatase-like protein, CTDSP-like, EC 3.1.3, HYA22, NIF1, NIFL, NIF-like protein, NLI-interacting factor 1, Nuclear LIM interactor-interacting factor 1, Protein YA22, PSR1, RB protein serine phosphatase from chromosome 3, RBSP3EC 3.1.3.16, SCP3chromosome 3 open reading frame 8, Small CTD phosphatase 3, Small C-terminal domain phosphatase 3, YA22 |
|---|
| Gene, Accession # | CTDSPL, Gene ID: 10217, Accession: O15194, SwissProt: O15194 |
|---|
| Catalog # | NBP2-31913 |
|---|
| Price | |
|---|
| Order / More Info | CTDSPL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|