| Edit |   |
| Antigenic Specificity | SLC4A5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SLC4A5 Antibody |
| Immunogen | The immunogen for Anti-SLC4A5 Antibody: synthetic peptide directed towards the middle region of human SLC4A5. Synthetic peptide located within the following region: SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL |
| Other Names | NBC4, solute carrier family 4 (sodium bicarbonate cotransporter), member 5 |
| Gene, Accession # | S4A5, Accession: NM_021196 |
| Catalog # | TA333726 |
| Price | |
| Order / More Info | SLC4A5 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |