| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRPS18B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRPS18B Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRPS18B. This antibody reacts with human. The MRPS18B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MRPS18B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP |
|---|
| Other Names | 28S ribosomal protein S18-2, mitochondrial, C6orf1428S ribosomal protein S18b, mitochondrial, HSPC183, HumanS18a, mitochondrial ribosomal protein S18-2, mitochondrial ribosomal protein S18B, MRP-S18-2, MRPS18-2DKFZp564H0223, Mrps18-b, MRP-S18-b, PTD017, S18amt, S18mt-b |
|---|
| Gene, Accession # | MRPS18B, Gene ID: 28973 |
|---|
| Catalog # | NBP2-48792 |
|---|
| Price | |
|---|
| Order / More Info | MRPS18B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|