| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CBARA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CBARA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBARA1. This antibody reacts with human. The CBARA1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Specificity of human CBARA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTY |
|---|
| Other Names | Allergen Hom s 4, ara CALC, Atopy-related autoantigen CALC, CALCDKFZp564C246, calcium binding atopy-related autoantigen 1, Calcium-binding atopy-related autoantigen 1, MICU1mitochondrial, mitochondrial calcium uptake 1 |
|---|
| Gene, Accession # | MICU1, Gene ID: 10367 |
|---|
| Catalog # | NBP2-58173 |
|---|
| Price | |
|---|
| Order / More Info | CBARA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|