| Edit |   |
|---|
| Antigenic Specificity | PNMA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PNMA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PNMA1. This antibody reacts with human. The PNMA1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PNMA1(paraneoplastic antigen MA1) The peptide sequence was selected from the middle region of PNMA1. Peptide sequence KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR. |
|---|
| Other Names | MA1Neuron- and testis-specific protein 1,37 kDa neuronal protein, paraneoplastic antigen MA1, paraneoplastic neuronal antigen MA1 |
|---|
| Gene, Accession # | PNMA1, Gene ID: 9240, Accession: Q8ND90, SwissProt: Q8ND90 |
|---|
| Catalog # | NBP1-52935 |
|---|
| Price | |
|---|
| Order / More Info | PNMA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|