| Edit |   |
|---|
| Antigenic Specificity | HEXDC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-HEXDC Antibody |
|---|
| Immunogen | The immunogen for anti-HEXDC antibody: synthetic peptide directed towards the middle region of human HEXDC. Synthetic peptide located within the following region: CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA |
|---|
| Other Names | hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing |
|---|
| Gene, Accession # | HEXDC, Accession: NM_173620 |
|---|
| Catalog # | TA331402 |
|---|
| Price | |
|---|
| Order / More Info | HEXDC Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|