| Edit |   |
|---|
| Antigenic Specificity | FLJ21963 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FLJ21963 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FLJ21963. This antibody reacts with human. The FLJ21963 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FLJ21963 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVK |
|---|
| Other Names | acyl-CoA synthetase short-chain family member 3, acyl-CoA synthetase short-chain family member 3, mitochondrial, EC 6.2.1, EC 6.2.1.1, FLJ21963 |
|---|
| Gene, Accession # | ACSS3, Gene ID: 79611 |
|---|
| Catalog # | NBP2-56976 |
|---|
| Price | |
|---|
| Order / More Info | FLJ21963 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|