| Edit |   |
| Antigenic Specificity | FLJ37543 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FLJ37543 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FLJ37543. This antibody reacts with human. The FLJ37543 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human FLJ37543The immunogen for this antibody is FLJ37543. Peptide sequence PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS. |
| Other Names | chromosome 5 open reading frame 64 |
| Gene, Accession # | C5orf64, Gene ID: 285668, Accession: NP_775938, SwissProt: NP_775938 |
| Catalog # | NBP1-79600-20ul |
| Price | |
| Order / More Info | FLJ37543 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |