| Edit |   |
| Antigenic Specificity | FLJ40504 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FLJ40504 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FLJ40504. This antibody reacts with human. The FLJ40504 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FLJ40504(hypothetical protein FLJ40504) The peptide sequence was selected from the N terminal of FLJ40504. Peptide sequence MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL. |
| Other Names | FLJ40504, keratin 18 pseudogene 55, MGC138231, MGC138233 |
| Gene, Accession # | KRT18P55, Gene ID: 284085, Accession: Q8N7Q0, SwissProt: Q8N7Q0 |
| Catalog # | NBP1-56798 |
| Price | |
| Order / More Info | FLJ40504 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |