| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Proteasome 20S alpha 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Proteasome 20S alpha 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proteasome 20S alpha 3. This antibody reacts with human, mouse. The Proteasome 20S alpha 3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PSMA3(proteasome (prosome, macropain) subunit, alpha type, 3) The peptide sequence was selected from the middle region of PSMA3. Peptide sequence VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN. |
|---|
| Other Names | EC 3.4.25.1, HC8MGC32631, Macropain subunit C8, MGC12306, Multicatalytic endopeptidase complex subunit C8, proteasome (prosome, macropain) subunit, alpha type, 3, Proteasome component C8, proteasome subunit alpha type-3, proteasome subunit C8, PSC3, PSC8 |
|---|
| Gene, Accession # | PSMA3, Gene ID: 5684, Accession: P25788-2, SwissProt: P25788-2 |
|---|
| Catalog # | NBP1-54374-20ul |
|---|
| Price | |
|---|
| Order / More Info | Proteasome 20S alpha 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|