| 产品详情 |
| Edit |   |
| Antigenic Specificity | Proteasome 20S alpha 5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Proteasome 20S alpha 5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proteasome 20S alpha 5. This antibody reacts with human. The Proteasome 20S alpha 5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Proteasome 20S alpha 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI |
| Other Names | EC 3.4.25.1, FLJ42315, macropain subunit zeta, Macropain zeta chain, MGC117302, MGC125802, MGC125803, MGC125804, Multicatalytic endopeptidase complex zeta chain, proteasome (prosome, macropain) subunit, alpha type, 5, proteasome alpha 5 subunit, proteasome component 5, proteasome subunit alpha type-5, proteasome subunit zeta, Proteasome zeta chain, PSC5, ZETA |
| Gene, Accession # | PSMA5, Gene ID: 5686 |
| Catalog # | NBP1-86838 |
| Price | |
| Order / More Info | Proteasome 20S alpha 5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|