| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Proteasome 20S alpha 5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Proteasome 20S alpha 5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proteasome 20S alpha 5. This antibody reacts with human. The Proteasome 20S alpha 5 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: alpha type-5 |
|---|
| Immunogen | Synthetic peptides corresponding to PSMA5(proteasome (prosome, macropain) subunit, alpha type, 5) The peptide sequence was selected from the N terminal of PSMA5 (NP_002781). Peptide sequence MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV. |
|---|
| Other Names | EC 3.4.25.1, FLJ42315, macropain subunit zeta, Macropain zeta chain, MGC117302, MGC125802, MGC125803, MGC125804, Multicatalytic endopeptidase complex zeta chain, proteasome (prosome, macropain) subunit, alpha type, 5, proteasome alpha 5 subunit, proteasome component 5, proteasome subunit alpha type-5, proteasome subunit zeta, Proteasome zeta chain, PSC5, ZETA |
|---|
| Gene, Accession # | PSMA5, Gene ID: 5686, Accession: P28066, SwissProt: P28066 |
|---|
| Catalog # | NBP1-56843 |
|---|
| Price | |
|---|
| Order / More Info | Proteasome 20S alpha 5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|