| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCR7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCR7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCR7. This antibody reacts with human. The CCR7 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CCR7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA |
|---|
| Other Names | BLR2C-C chemokine receptor type 7, C-C CKR-7, CC-CKR-7, CCR-7, CD197, CD197 antigen, CDw197CC chemokine receptor 7, chemokine (C-C motif) receptor 7, CMKBR7chemokine (C-C) receptor 7, EBI1EBV-induced G protein-coupled receptor 1, EBV-induced G-protein coupled receptor 1, Epstein-Barr virus induced gene 1, Epstein-Barr virus induced G-protein coupled receptor, Epstein-Barr virus-induced G-protein coupled receptor 1, EVI1, lymphocyte-specific G protein-coupled peptide receptor, MIP-3 beta receptor |
|---|
| Gene, Accession # | CCR7, Gene ID: 1236 |
|---|
| Catalog # | NBP2-57375 |
|---|
| Price | |
|---|
| Order / More Info | CCR7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|