| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LPAR2/LPA2/EDG-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 26418031). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LPAR2/LPA2/EDG-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LPAR2/LPA2/EDG-4. This antibody reacts with human. The LPAR2/LPA2/EDG-4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LPAR2/LPA2/EDG-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL |
|---|
| Other Names | EDG-4, EDG4FLJ93869, endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor4,LPA receptor EDG4, G protein-coupled receptor, LPA-2, LPA2LPA receptor 2, lysophosphatidic acid receptor 2, lysophosphatidic acid receptor EDG4, Lysophosphatidic acid receptor Edg-4 |
|---|
| Gene, Accession # | LPAR2, Gene ID: 9170 |
|---|
| Catalog # | NBP1-84904 |
|---|
| Price | |
|---|
| Order / More Info | LPAR2/LPA2/EDG-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25002680, 26418031 |
|---|
| 产品资料 |
|
|