| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LPAR6/P2RY5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LPAR6/P2RY5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LPAR6/P2RY5. This antibody reacts with human. The LPAR6/P2RY5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LPAR6/P2RY5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESA |
|---|
| Other Names | G-protein coupled purinergic receptor P2Y5, LAH3, LPA receptor 6, LPA-6, lysophosphatidic acid receptor 6, MGC120358, Oleoyl-L-alpha-lysophosphatidic acid receptor, P2RY5ARWH1, P2Y purinoceptor 5, P2Y5RB intron encoded G-protein coupled receptor, Purinergic receptor 5, purinergic receptor P2Y, G-protein coupled, 5 |
|---|
| Gene, Accession # | LPAR6, Gene ID: 10161 |
|---|
| Catalog # | NBP2-14197 |
|---|
| Price | |
|---|
| Order / More Info | LPAR6/P2RY5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|