| 产品详情 |
| Edit |   |
| Antigenic Specificity | Nicotinic Acetylcholine R alpha 5/CHRNA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nicotinic Acetylcholine R alpha 5/CHRNA5. This antibody reacts with human, mouse. The Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: alpha-5 |
| Immunogen | Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD. |
| Other Names | Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5, cholinergic receptor, nicotinic, alpha 5, cholinergic receptor, nicotinic, alpha polypeptide 5, LNCR2, NACHRA5, neuronal acetylcholine receptor subunit alpha-5, neuronal nicotinic acetylcholine receptor, alpha5 subunit |
| Gene, Accession # | CHRNA5, Gene ID: 1138 |
| Catalog # | NBP1-69122 |
| Price | |
| Order / More Info | Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26904947, 27028622 |
| 产品资料 |
|
|