| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nicotinic Acetylcholine R alpha 9/CHRNA9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nicotinic Acetylcholine R alpha 9/CHRNA9. This antibody reacts with human. The Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human CHRNA9The immunogen for this antibody is CHRNA9. Peptide sequence MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE. |
|---|
| Other Names | cholinergic receptor, nicotinic, alpha 9, cholinergic receptor, nicotinic, alpha polypeptide 9, HSA243342, MGC142109, MGC142135, NACHR alpha 9, NACHR alpha-9, NACHRA9acetylcholine receptor, neuronal nicotinic, alpha-9 subunit, neuronal acetylcholine receptor protein, alpha-9 subunit, neuronal acetylcholine receptor subunit alpha-9, nicotinic acetylcholine receptor subunit alpha 9, Nicotinic acetylcholine receptor subunit alpha-9 |
|---|
| Gene, Accession # | CHRNA9, Gene ID: 55584, Accession: NP_060051, SwissProt: NP_060051 |
|---|
| Catalog # | NBP1-79949 |
|---|
| Price | |
|---|
| Order / More Info | Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|