| Edit |   |
|---|
| Antigenic Specificity | Nidogen-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nidogen-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nidogen-2. This antibody reacts with human. The Nidogen-2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NID2(nidogen 2 (osteonidogen)) The peptide sequence was selected from the middle region of NID2. Peptide sequence DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV. |
|---|
| Other Names | NID-2, nidogen 2 (osteonidogen), nidogen-2, osteonidogen |
|---|
| Gene, Accession # | NID2, Gene ID: 22795, Accession: Q14112, SwissProt: Q14112 |
|---|
| Catalog # | NBP1-59148-20ul |
|---|
| Price | |
|---|
| Order / More Info | Nidogen-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|