| Edit |   |
|---|
| Antigenic Specificity | PEX11G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-PEX11G Antibody |
|---|
| Immunogen | The immunogen for Anti-PEX11G Antibody is: synthetic peptide directed towards the C-terminal region of Human PEX11G. Synthetic peptide located within the following region: LANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATTP |
|---|
| Other Names | peroxisomal biogenesis factor 11 gamma |
|---|
| Gene, Accession # | PX11C, Accession: NM_080662 |
|---|
| Catalog # | TA331673 |
|---|
| Price | |
|---|
| Order / More Info | PEX11G Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|