| Edit |   |
| Antigenic Specificity | PEX5L - C-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human; mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PEX5L Antibody - C-terminal region |
| Immunogen | The immunogen for anti-Pex2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA |
| Other Names | PEX5R, PEX5RP, PXR2, PXR2B, TRIP8b, peroxisomal biogenesis factor 5-like |
| Gene, Accession # | PEX5R, Accession: NM_016559 |
| Catalog # | TA345010 |
| Price | |
| Order / More Info | PEX5L - C-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |