| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCCA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCCA Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCCA. This antibody reacts with human. The PCCA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PCCA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGV RVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNY |
|---|
| Other Names | EC 6.4.1, EC 6.4.1.3, pccA complementation group, PCCase alpha subunit, PCCase subunit alpha, propanoyl-CoA:carbon dioxide ligase alpha subunit, Propanoyl-CoA:carbon dioxide ligase subunit alpha, propionyl CoA carboxylase, alpha polypeptide, propionyl Coenzyme A carboxylase, alpha polypeptide, propionyl-CoA carboxylase alpha chain, mitochondrial |
|---|
| Gene, Accession # | PCCA, Gene ID: 5095 |
|---|
| Catalog # | NBP2-13736 |
|---|
| Price | |
|---|
| Order / More Info | PCCA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|