| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UCH-L5/UCH37 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UCH-L5/UCH37 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UCH-L5/UCH37. This antibody reacts with human. The UCH-L5/UCH37 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human UCH-L5/UCH37 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT |
|---|
| Other Names | EC 3.4.19.12, INO80 complex subunit R, INO80R, ubiquitin carboxyl-terminal esterase L5, ubiquitin carboxyl-terminal hydrolase isozyme L5, ubiquitin carboxyl-terminal hydrolase L5, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin thioesterase L5, UCH37CGI-70, UCH-L5 |
|---|
| Gene, Accession # | UCHL5, Gene ID: 51377 |
|---|
| Catalog # | NBP1-85656 |
|---|
| Price | |
|---|
| Order / More Info | UCH-L5/UCH37 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|