| 产品详情 |
| Edit |   |
| Antigenic Specificity | UCH-L5/UCH37 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UCH-L5/UCH37 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UCH-L5/UCH37. This antibody reacts with human. The UCH-L5/UCH37 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human UCH-L5/UCH37 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT |
| Other Names | EC 3.4.19.12, INO80 complex subunit R, INO80R, ubiquitin carboxyl-terminal esterase L5, ubiquitin carboxyl-terminal hydrolase isozyme L5, ubiquitin carboxyl-terminal hydrolase L5, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin thioesterase L5, UCH37CGI-70, UCH-L5 |
| Gene, Accession # | UCHL5, Gene ID: 51377 |
| Catalog # | NBP2-57955 |
| Price | |
| Order / More Info | UCH-L5/UCH37 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|