| Edit |   |
|---|
| Antigenic Specificity | Intelectin-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Intelectin-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Intelectin-2. This antibody reacts with human. The Intelectin-2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ITLN2The immunogen for this antibody is ITLN2. Peptide sequence TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA. |
|---|
| Other Names | HL-2, intelectin 2, UNQ2789/PRO7179 |
|---|
| Gene, Accession # | ITLN2, Gene ID: 142683, Accession: NP_543154, SwissProt: NP_543154 |
|---|
| Catalog # | NBP1-79341 |
|---|
| Price | |
|---|
| Order / More Info | Intelectin-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|