| 产品详情 |
| Edit |   |
| Antigenic Specificity | Kir3.4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25776071). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Kir3.4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kir3.4. This antibody reacts with human. The Kir3.4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kir3 |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY |
| Other Names | Cardiac inward rectifier, CIRKIR3.4, G protein-activated inward rectifier potassium channel 4, GIRK-4, GIRK4Kir3.4, Heart KATP channel, Inward rectifier K(+) channel Kir3.4, inward rectifier K+ channel KIR3.4, IRK-4, KATP-1, KATP1cardiac ATP-sensitive potassium channel, LQT13, Potassium channel, inwardly rectifying subfamily J member 5, potassium inwardly-rectifying channel, subfamily J, member 5 |
| Gene, Accession # | KCNJ5, Gene ID: 3762 |
| Catalog # | NBP1-88081 |
| Price | |
| Order / More Info | Kir3.4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23913004, 25776071 |
| 产品资料 |
|
|