| Edit |   |
|---|
| Antigenic Specificity | D-Glutamate Cyclase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The D-Glutamate Cyclase Antibody from Novus Biologicals is a rabbit polyclonal antibody to D-Glutamate Cyclase. This antibody reacts with human. The D-Glutamate Cyclase Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C2orf37 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EQETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICD |
|---|
| Other Names | Chromosome 2 Open Reading Frame 37, DCAF17, DDB1 And CUL4 Associated Factor 17, DDB1- And CUL4-Associated Factor 17 |
|---|
| Gene, Accession # | DCAF17, Gene ID: 80067, Accession: Q5H9S7, SwissProt: Q5H9S7 |
|---|
| Catalog # | NBP2-30715 |
|---|
| Price | |
|---|
| Order / More Info | D-Glutamate Cyclase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|