| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DHDH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DHDH Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHDH. This antibody reacts with human. The DHDH Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DHDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPT |
|---|
| Other Names | 3-deoxyglucosone reductase, dihydrodiol dehydrogenase (dimeric), Dimeric dihydrodiol dehydrogenase, D-xylose 1-dehydrogenase, D-xylose-NADP dehydrogenase, EC 1.1.1.179,2DD, EC 1.3.1.20, Hum2DD, trans-1,2-dihydrobenzene-1,2-diol dehydrogenase |
|---|
| Gene, Accession # | DHDH, Gene ID: 27294 |
|---|
| Catalog # | NBP1-91831 |
|---|
| Price | |
|---|
| Order / More Info | DHDH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|