| Edit |   |
|---|
| Antigenic Specificity | LRRC52 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC52 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC52. This antibody reacts with human. The LRRC52 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LRRC52(leucine rich repeat containing 52) Antibody(against the N terminal of LRRC52. Peptide sequence QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC. |
|---|
| Other Names | FLJ25811, leucine rich repeat containing 52, leucine-rich repeat-containing protein 52 |
|---|
| Gene, Accession # | LRRC52, Gene ID: 440699 |
|---|
| Catalog # | NBP1-70625-20ul |
|---|
| Price | |
|---|
| Order / More Info | LRRC52 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|